PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN24547.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 234aa    MW: 27129.2 Da    PI: 8.0268
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN24547.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding551.9e-17449147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l ++v+ +G+++W++Ia+++  gR++k+c++rw++ 
       KHN24547.1  4 RGHWRPAEDEKLRELVEHYGPHNWNAIAEKLR-GRSGKSCRLRWFNQ 49
                     899*****************************.***********996 PP

2Myb_DNA-binding58.21.8e-1856100147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r+++T+eE+e+l+  ++ +G++ W+ Iar+++ gRt++ +k++w+  
       KHN24547.1  56 RNPFTEEEEERLLASHRIHGNR-WAVIARHFP-GRTDNAVKNHWHVM 100
                      789*******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.644154IPR017930Myb domain
SMARTSM007174.2E-15352IPR001005SANT/Myb domain
SuperFamilySSF466891.33E-29497IPR009057Homeodomain-like
PfamPF002494.3E-17449IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.6E-27557IPR009057Homeodomain-like
CDDcd001675.28E-14748No hitNo description
PROSITE profilePS5129420.12955105IPR017930Myb domain
SMARTSM007171.1E-1655103IPR001005SANT/Myb domain
PfamPF002492.0E-155699IPR001005SANT/Myb domain
CDDcd001676.76E-1358101No hitNo description
Gene3DG3DSA:1.10.10.602.4E-2158103IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MCSRGHWRPA EDEKLRELVE HYGPHNWNAI AEKLRGRSGK SCRLRWFNQL DPRINRNPFT  60
EEEEERLLAS HRIHGNRWAV IARHFPGRTD NAVKNHWHVM MARIRRERSK INNPKLQPLF  120
APNLKDDLEA IPSFVEKYYE KYSHPCVTLT HSSFQFPGKK FYFQDPSSAG STVPPGKSQS  180
VEFYDFLQVN TDSNESEVTD NARRDDEEVS QDAVGQKNKD NGVPFIDFLS TGGC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-3141037106B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00145DAPTransfer from AT1G17950Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0928930.0BT092893.1 Soybean clone JCVI-FLGm-12J9 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003548323.11e-178PREDICTED: transcriptional activator Myb
TrEMBLA0A0B2QY271e-178A0A0B2QY27_GLYSO; Transcription factor MYB44-like protein
TrEMBLI1MQM91e-178I1MQM9_SOYBN; Uncharacterized protein
STRINGGLYMA16G34490.11e-177(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.14e-87myb domain protein 52
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]